PTM Viewer

For each protein all PTMs are highlighted by default in the respective protein sequence (right-hand side). One can adjust a selection of PTMs in the PTM table on the left-hand side. In addition, functional protein domains and sites can be underlined if desired.

In the PTM table per PTM the PTM position and type is indicated, as well as the plain peptide sequence that was identified by mass spectrometry. The respective proteomics study is indicated by a number, providing a link to consult the experimental details. Additional PTM meta-data includes various confidence measures such as peptide score provided by search algorithms, posterior error probability (PEP), precursor mass deviation (in ppm) and modification site probability. The available confidence meta-data can be consulted in the extended PTM table by clicking SHOW CONFIDENCE. However, in the default PTM table, a color-coding of confidence is provided with green indicating high confidence, olive medium confidence, grey low confidence, and no color an unassigned confidence. More details regarding this confidence assignment can be consulted in the tutorial or the Plant PTM Viewer manuscript.

Besides confidence measures, log2 fold changes between two conditions with significance values (P- or Q-values) are shown if provided in the respective publication. Log2 fold changes are colored in heatmap-like gradient (green = induced, red = repressed) and significant values are highlighted in green. To determine significance, we employed the threshold used in the respective publication. For more details on the quantitative measurements we refer to the experimental details and respective publication, as methodologies can differ.

On the bottom of the page one can send the whole protein or a part of the protein (i.e. a functional domain) to PTM Blast. This will display aligned protein sequences that potentially report aligned PTMs.

PTMs

Export
Results

PTM Type	Mod AA	Pos	Peptide	Exp ID	Log2 FC	P/Q val	Score Type	Ident Score	Loc Prob	PEP	Mass Error (ppm)
ph	T	49	LRHGETNSFLPIFREPSSIEK	100			XCorr	4.773	0.961	1.013e-5
			HGETNSFLPIFREPSSIEK	45			MaxQuant Score	131.250
			HGETNSFLPIFREPSSIEK	100			XCorr	4.011	0.974	1.279e-3
			HGETNSFLPIFR	88			MASCOT Score	37.000	1.000		-0.240
				100			XCorr	3.969	0.999	1.097e-5
				114			MaxQuant score	298.170	1.000	0.000e+0
ph	S	51	LRHGETNSFLPIFR	100			XCorr	4.375	1.000	3.719e-4
			HGETNSFLPIFR	88			MASCOT Score	41.000	0.928		-2.400
			HGETNSFLPIFR	114			MaxQuant score	196.670	1.000	1.357e-24
ph	T	81	DHNLVFRPPTPDRPNPYSASPPPRPASPR	100			XCorr	3.997	0.966	4.192e-3
ph	S	91	DHNLVFRPPTPDRPNPYSASPPPRPASPR	84b			XCorr	3.090	0.756	3.483e-4
ph	S	91	DHNLVFRPPTPDRPNPYSASPPPRPASPR	100			XCorr	3.997	0.896	4.192e-3
ph	S	98	DHNLVFRPPTPDRPNPYSASPPPRPASPR	100			XCorr	3.997	0.981	4.192e-3
ph	S	103	VASPRPTSPR	60			MASCOT Score	30.200			0.421
				85			XCorr	2.067	0.893	1.065e-2
				109					1.000
				114			MaxQuant score	102.730	1.000	1.100e-4
ph	T	107	VASPRPTSPR	60			MASCOT Score	30.200			0.421
				88			MASCOT Score	25.000	0.818		0.700
				114			MaxQuant score	83.087	0.926	1.542e-3
ph	S	108	VASPRPTSPR	60			MASCOT Score	43.720			-0.361
				111a	0.405	0.000		33.280			0.669
				111b	0.405	0.000		33.280			0.669
				111c	1.800	0.000		33.280			0.669
				111d	1.800	0.000		33.280			0.669
				114			MaxQuant score	124.210	0.999	2.624e-5
ph	S	113	VASPRVPSPR	60			MASCOT Score	33.160			1.448
ph	T	126	TLSPKPPSPR	61a			MASCOT Score	24.000	1.000
ph	S	128	TLSPKPPSPR	34			MASCOT Score	40.000			11.746
				46			MASCOT Score	41.230			-1.987
				61a			MASCOT Score	25.000	1.000
				83			MASCOT Score	33.000			0.000
				84b	-1.155		XCorr	2.180	0.944	3.949e-2
				85			XCorr	2.148	0.955	1.012e-3
				88			MASCOT Score	36.000	0.992		-1.750
				100			XCorr	2.891	0.984	1.096e-3
				106			MASCOT Score	27.000
				109					1.000
				111a	-0.002	0.000		38.750			-0.516
				111b	-0.002	0.000		38.750			-0.516
				111c	-0.070	0.000		38.750			-0.516
				111d	-0.070	0.000		38.750			-0.516
				114			MaxQuant score	132.500	1.000	1.351e-5
ph	S	133	TLSPKPPSPR	34			MASCOT Score	40.000			11.746
				46			MASCOT Score	41.230			-1.987
				61a			MASCOT Score	24.000	1.000
				83			MASCOT Score	33.000			0.000
				84b	-1.155		XCorr	2.180	0.995	3.949e-2
				85			XCorr	2.148	1.000	1.012e-3
				88			MASCOT Score	36.000	1.000		-1.750
				100			XCorr	2.891	1.000	1.096e-3
				106			MASCOT Score	27.000
				109					1.000
				111a	-0.259	0.000		29.170			0.109
				111b	-0.259	0.000		29.170			0.109
				111c	-0.907	0.000		29.170			0.109
				111d	-0.907	0.000		29.170			0.109
				114			MaxQuant score	142.100	1.000	2.109e-6
ph	S	141	SLSPKPPSPR	46			MASCOT Score	32.220			16.733
ph	S	143	SLSPKPPSPR	23
				46			MASCOT Score	36.330			9.821
				83			MASCOT Score	26.000			0.001
				84b			XCorr	2.300	0.943	6.521e-2
				85			XCorr	2.277	0.938	8.013e-3
				88			MASCOT Score	31.000	1.000		0.260
				100			XCorr	2.549	0.984	3.342e-5
				106			MASCOT Score	24.000
				109					1.000
				111a	0.104	0.000		27.570			0.997
				111b	0.104	0.000		27.570			0.997
				111c	-0.743	0.000		27.570			0.997
				111d	-0.743	0.000		27.570			0.997
				114			MaxQuant score	145.810	1.000	1.293e-6
ub	K	145	SLSPKPPSPRADLPR	2
ph	S	148	SLSPKPPSPR	46			MASCOT Score	36.330			9.821
				83			MASCOT Score	24.000			0.001
				84b			XCorr	2.300	1.000	6.521e-2
				85			XCorr	2.277	1.000	8.013e-3
				88			MASCOT Score	32.000	1.000		-1.070
				100			XCorr	2.848	1.000	1.882e-3
				106			MASCOT Score	25.000
				109					1.000
				111a	-0.214	0.000		26.090			-1.150
				111b	-0.214	0.000		26.090			-1.150
				111c	-1.180	0.000		26.090			-1.150
				111d	-1.180	0.000		26.090			-1.150
				114			MaxQuant score	147.420	1.000	1.394e-6
ph	S	156	SLSPKPFDR	46			MASCOT Score	38.590			18.957
ph	S	158	SLSPKPFDR	30			MASCOT Score	35.294			-1.518
				46			MASCOT Score	42.870			17.361
				59			MASCOT Score	31.000			-1.155
				60			MASCOT Score	39.410			0.326
				83			MASCOT Score	40.000			-0.000
				88			MASCOT Score	34.000	0.992		0.440
				97
				106			MASCOT Score	29.000
				109					0.999
				114			MaxQuant score	124.390	1.000	3.491e-4
				136	0.266	0.178	MASCOT score	42.920			7.130
ph	S	194	ITPHSVPSPRPSSPR	83			MASCOT Score	31.000			-0.001
ph	S	197	ITPHSVPSPRPSSPR	83			MASCOT Score	32.000			-0.000
				94			MaxQuant Score	62.162	0.960	1.600e-2	-0.500
				114			MaxQuant score	112.910	0.995	1.312e-6
ph	S	201	ITPHSVPSPRPSSPR	83			MASCOT Score	32.000			-0.000
ph	S	201	ITPHSVPSPRPSSPR	114			MaxQuant score	164.970	0.820	1.163e-13
ph	S	202	ITPHSVPSPRPSSPR	83			MASCOT Score	31.000			-0.001
				94			MaxQuant Score	62.162	0.801	1.600e-2	-0.500
				100			XCorr	3.101	0.930	4.764e-3
ph	S	207	GASPQAISSKPPSPR	84b			XCorr	3.260	1.000	4.806e-4
				85			XCorr	2.489	0.994	4.818e-3
				88			MASCOT Score	51.000	1.000		0.660
				100			XCorr	3.837	1.000	2.062e-4
				106			MASCOT Score	31.000
				109					1.000
				114			MaxQuant score	199.750	1.000	1.138e-34
ph	S	212	GASPQAISSKPPSPR	100			XCorr	3.764	0.886	2.475e-2
				106			MASCOT Score	34.000
				109					0.775
				114			MaxQuant score	110.820	0.828	1.038e-5
ph	S	213	GASPQAISSKPPSPR	83			MASCOT Score	26.000			-0.002
				84b			XCorr	3.260	0.873	4.806e-4
				88			MASCOT Score	41.000	0.999		-1.210
				109					0.920
				114			MaxQuant score	210.070	0.998	1.401e-45
ph	S	217	GASPQAISSKPPSPR	23
				83			MASCOT Score	26.000			-0.002
				84b			XCorr	3.260	0.978	4.806e-4
				85			XCorr	2.489	1.000	4.818e-3
				88			MASCOT Score	56.000	1.000		0.260
				100			XCorr	3.764	1.000	2.475e-2
				106			MASCOT Score	37.000
				109					1.000
				111a	-0.683	0.000		58.350			0.284
				111b	-0.683	0.000		58.350			0.284
				111c	0.628	0.000		58.350			0.284
				111d	0.628	0.000		58.350			0.284
				114			MaxQuant score	281.650	1.000	0.000e+0
ph	T	227	AEPPTLDTPRPPSPR	114			MaxQuant score	75.970	0.855	1.506e-4
ph	S	232	AEPPTLDTPRPPSPR	38			MASCOT Score	61.880			-1.055
				60			MASCOT Score	44.420			-0.447
				85			XCorr	2.634	0.999	1.883e-3
				88			MASCOT Score	37.000	1.000		0.570
				100			XCorr	3.209	1.000	1.044e-5
				106			MASCOT Score	25.000
				114			MaxQuant score	211.200	1.000	1.401e-45
ph	S	237	AASLRADPPR	114			MaxQuant score	85.522	1.000	5.011e-4
ph	T	251	LDAARPTTPRPPSPLADAPR	100			XCorr	3.371	0.981	3.224e-3
			LDAARPTTPRPPSPLADAPR	114			MaxQuant score	133.760	0.935	1.872e-21
			PTTPRPPSPLADAPR	88			MASCOT Score	21.000	0.990		0.290
ph	T	252	LDAARPTTPRPPSPLADAPR	48			MASCOT Score	22.660
ph	T	252	PTTPRPPSPLADAPR	114			MaxQuant score	188.960	1.000	1.481e-26
ph	S	257	LDAARPTTPRPPSPLADAPR	44			XCorr	2.945
				48			MASCOT Score	22.660
				85			XCorr	2.828	1.000	1.506e-3
				100			XCorr	3.371	1.000	3.224e-3
				109					1.000
			PTTPRPPSPLADAPR	88			MASCOT Score	30.000	1.000		0.520
			PTTPRPPSPLADAPR	114			MaxQuant score	153.100	1.000	1.820e-25
ph	T	271	LDAPRPTTPKPPSPR	23
				83			MASCOT Score	25.000			-0.000
				111a	-0.160	0.000		25.180			2.540
				111b	-0.160	0.000		25.180			2.540
				111c	-0.803	0.000		25.180			2.540
				111d	-0.803	0.000		25.180			2.540
				114			MaxQuant score	118.720	0.790	1.441e-5
ph	T	272	LDAPRPTTPKPPSPR	83			MASCOT Score	28.000			-0.000
				85			XCorr	2.965	0.914	4.468e-5
				100			XCorr	3.408	0.906	2.911e-5
				109					0.838
				111a	0.788	0.000		22.780			1.426
				111b	0.788	0.000		22.780			1.426
				111c	1.260	0.000		22.780			1.426
				111d	1.260	0.000		22.780			1.426
			PTTPKPPSPR	88			MASCOT Score	27.000	1.000		-0.780
			PTTPKPPSPR	114			MaxQuant score	148.620	0.997	8.184e-8
ph	S	277	LDAPRPTTPKPPSPR	23
				48			MASCOT Score	27.180
				83			MASCOT Score	28.000			-0.000
				84a			XCorr	2.000	0.937	2.911e-1
				85			XCorr	2.965	1.000	4.468e-5
				88			MASCOT Score	24.000	1.000		-0.120
				100			XCorr	3.408	1.000	2.911e-5
				109					1.000
				111a	0.089	0.000		30.400			0.029
				111b	0.089	0.000		30.400			0.029
				111c	0.566	0.000		30.400			0.029
				111d	0.566	0.000		30.400			0.029
			PTTPKPPSPR	88			MASCOT Score	32.000	1.000		-0.290
			PTTPKPPSPR	114			MaxQuant score	156.670	1.000	1.119e-12
ph	T	291	LDAPRPTTPKPPSPR	23
				83			MASCOT Score	25.000			-0.000
				111a	-0.160	0.000		25.180			2.540
				111b	-0.160	0.000		25.180			2.540
				111c	-0.803	0.000		25.180			2.540
				111d	-0.803	0.000		25.180			2.540
				114			MaxQuant score	118.720	0.790	1.441e-5
ph	T	292	SDPPRLDAPRPTTPKPPSPR	83			MASCOT Score	27.000			0.000
			SDPPRLDAPRPTTPKPPSPR	100			XCorr	2.785	0.773	3.239e-3
			LDAPRPTTPKPPSPR	83			MASCOT Score	28.000			-0.000
				85			XCorr	2.965	0.914	4.468e-5
				100			XCorr	3.408	0.906	2.911e-5
				109					0.838
				111a	0.788	0.000		22.780			1.426
				111b	0.788	0.000		22.780			1.426
				111c	1.260	0.000		22.780			1.426
				111d	1.260	0.000		22.780			1.426
			PTTPKPPSPR	88			MASCOT Score	27.000	1.000		-0.780
			PTTPKPPSPR	114			MaxQuant score	148.620	0.997	8.184e-8
ph	S	297	SDPPRLDAPRPTTPKPPSPR	83			MASCOT Score	27.000			0.000
			SDPPRLDAPRPTTPKPPSPR	100			XCorr	2.785	1.000	3.239e-3
			LDAPRPTTPKPPSPR	23
				48			MASCOT Score	27.180
				83			MASCOT Score	28.000			-0.000
				84a			XCorr	2.000	0.937	2.911e-1
				85			XCorr	2.965	1.000	4.468e-5
				88			MASCOT Score	24.000	1.000		-0.120
				100			XCorr	3.408	1.000	2.911e-5
				109					1.000
				111a	0.089	0.000		30.400			0.029
				111b	0.089	0.000		30.400			0.029
				111c	0.566	0.000		30.400			0.029
				111d	0.566	0.000		30.400			0.029
			PTTPKPPSPR	88			MASCOT Score	32.000	1.000		-0.290
			PTTPKPPSPR	114			MaxQuant score	156.670	1.000	1.119e-12
ph	S	300	RSVSPR	111a	3.329	0.000		22.220			0.192
ph	S	300	RSVSPR	111b	3.329	0.000		22.220			0.192
ph	S	302	RSVSPR	111a	3.329	0.000		22.220			0.192
ph	S	302	RSVSPR	111b	3.329	0.000		22.220			0.192
ph	T	318	EIVYRPEPTLPVQHASATK	114			MaxQuant score	75.896	0.860	8.026e-5
ph	S	379	VQSQIQSR	88			MASCOT Score	43.000	1.000		0.720
ph	S	379	VQSQIQSR	114			MaxQuant score	96.240	1.000	5.143e-3
ph	S	405	WAASEAGNDNWDDSVLTK	100			XCorr	4.082	1.000	1.960e-6
				109					0.999
				114			MaxQuant score	304.290	1.000	0.000e+0
ph	S	439	ERSMAYAYSR	109					0.998
ph	S	439	ERSMAYAYSR	114			MaxQuant score	109.510	1.000	6.020e-5
ph	S	445	SMAYAYSR	114			MaxQuant score	64.439	0.999	1.540e-2
ph	S	477	QNPLASPAPSYSQPQR	23
				88			MASCOT Score	73.000	1.000		-0.410
				100			XCorr	4.048	0.998	3.169e-4
				106			MASCOT Score	52.000
				109					0.996
				111a	-0.019	0.000		32.350			1.572
				111b	-0.019	0.000		32.350			1.572
				111c	-3.377	0.000		32.350			1.572
				111d	-3.377	0.000		32.350			1.572
				114			MaxQuant score	331.640	1.000	0.000e+0
				136	-0.236	0.216	MASCOT score	71.480			6.909
ph	S	481	QNPLASPAPSYSQPQR	88			MASCOT Score	73.000	0.934		-0.410
ph	S	481	QNPLASPAPSYSQPQR	114			MaxQuant score	274.790	0.995	0.000e+0
ph	Y	482	QNPLASPAPSYSQPQR	100			XCorr	3.507	0.807	7.540e-3
				106			MASCOT Score	36.000
				111a	-0.019	0.000		32.350			1.572
				111b	-0.019	0.000		32.350			1.572
				111c	-3.377	0.000		32.350			1.572
				111d	-3.377	0.000		32.350			1.572
ph	S	483	QNPLASPAPSYSQPQR	114			MaxQuant score	146.860	0.775	4.807e-10
ph	T	492	DFRLTPSR	100			XCorr	2.239	0.938	2.984e-3
ph	T	492	DFRLTPSR	114			MaxQuant score	163.120	1.000	5.029e-3
ph	S	499	LCPSPLSQSSK	44			XCorr	2.924
				88			MASCOT Score	43.000	1.000		-0.480
				114			MaxQuant score	124.470	1.000	1.251e-5
ph	S	502	LCPSPLSQSSK	88			MASCOT Score	43.000	0.998		-0.480
ph	S	502	LCPSPLSQSSK	114			MaxQuant score	124.470	0.982	1.251e-5
ph	S	504	LCPSPLSQSSK	88			MASCOT Score	33.000	0.998		-0.190
ph	S	504	LCPSPLSQSSK	114			MaxQuant score	127.490	0.831	3.357e-8
ph	S	505	LCPSPLSQSSKQHHIR	114			MaxQuant score	112.440	0.840	3.196e-5
ph	T	518	LDNHFDTSTPRSSR	88			MASCOT Score	35.000	1.000		-0.210
ph	S	519	LDNHFDTSTPR	88			MASCOT Score	37.000	0.995		0.270
				106			MASCOT Score	24.000
				114			MaxQuant score	159.410	0.788	1.288e-10
ph	T	520	LDNHFDTSTPR	100			XCorr	3.369	0.934	1.947e-3
				111a	2.896	0.000		50.540			0.833
				111b	2.896	0.000		50.540			0.833
				111c	-0.842	0.000		50.540			0.833
				111d	-0.842	0.000		50.540			0.833
				114			MaxQuant score	216.060	0.992	7.803e-32
ph	S	523	LDNHFDTSTPRSSR	88			MASCOT Score	35.000	0.994		-0.210
ph	S	523	LDNHFDTSTPRSSR	114			MaxQuant score	114.750	0.961	7.143e-5
ph	S	526	STFHTPSRPIHTGTSR	114			MaxQuant score	108.710	0.860	8.710e-8
ph	T	527	STFHTPSRPIHTGTSR	114			MaxQuant score	155.940	0.929	8.144e-14
ph	T	530	STFHTPSRPIHTGTSR	109					0.974
ph	T	530	STFHTPSRPIHTGTSR	114			MaxQuant score	181.320	1.000	1.016e-26
ph	S	552	LRGQDSPFKDDDSLTSCPPFPSYMAPTVSAK	114			MaxQuant score	159.910	0.990	0.000e+0
ph	S	552	GQDSPFK	100			XCorr	2.112	1.000	1.181e-2
ph	S	559	LRGQDSPFKDDDSLTSCPPFPSYMAPTVSAK	114			MaxQuant score	206.730	0.988	0.000e+0
ph	S	584	VRPNSNPKER	114			MaxQuant score	47.915	1.000	1.318e-2
ph	S	584	VRPNSNPK	88			MASCOT Score	27.000	1.000		-1.590
ph	T	593	VMGTPVSEKR	88			MASCOT Score	26.000	1.000		0.000
			VMGTPVSEKR	114			MaxQuant score	160.980	1.000	8.113e-5
			VMGTPVSEK	44			XCorr	2.663
				88			MASCOT Score	49.000	1.000		-1.070
				100			XCorr	2.971	0.926	3.923e-3
				106			MASCOT Score	21.000
ph	S	596	VMGTPVSEKR	88			MASCOT Score	26.000	1.000		0.000
			VMGTPVSEKR	114			MaxQuant score	99.752	1.000	3.587e-4
			VMGTPVSEK	88			MASCOT Score	49.000	1.000		-1.070
			VMGTPVSEK	109					1.000
ph	S	602	RMSYPPTQDTFR	88			MASCOT Score	36.000	1.000		-1.270
ph	S	602	RMSYPPTQDTFR	114			MaxQuant score	89.992	1.000	3.107e-4
ph	S	616	WNKGSLVMSNSSSHR	114			MaxQuant score	120.790	1.000	8.462e-7
ph	S	620	GSLVMSNSSSHR	114			MaxQuant score	75.445	0.847	4.008e-5
ph	S	622	GSLVMSNSSSHRGPGSPGGVVLEK	114			MaxQuant score	214.420	0.887	0.000e+0
ph	S	622	GSLVMSNSSSHR	88			MASCOT Score	48.000	0.941		-0.610
ph	S	630	GSLVMSNSSSHRGPGSPGGVVLEK	100			XCorr	4.148	0.999	6.461e-5
			GPGSPGGVVLEK	23
				25
				38			MASCOT Score	64.180			-0.383
				44			XCorr	2.643
				60			MASCOT Score	43.280			-0.434
				83			MASCOT Score	71.000			0.000
				84a			XCorr	2.030	1.000	2.491e-2
				88			MASCOT Score	54.000	1.000		0.390
				97
				100			XCorr	3.653	1.000	1.730e-3
				106			MASCOT Score	24.000
				109					1.000
				111a	-0.186	0.000		59.560			-0.027
				111b	-0.186	0.000		59.560			-0.027
				111c	-0.342	0.000		59.560			-0.027
				111d	-0.342	0.000		59.560			-0.027
				114			MaxQuant score	254.890	1.000	0.000e+0
				136	-0.077	0.261	MASCOT score	72.840			5.313
ph	S	644	SVGNLSIGSTASMATTVGR	114			MaxQuant score	164.020	1.000	3.180e-23
ph	S	649	SVGNLSIGSTASMATTVGR	23
ph	S	649	SVGNLSIGSTASMATTVGR	114			MaxQuant score	157.850	1.000	1.974e-34

Sequence

Length: 669

MVKKGSWFSAIKRVFTPHSKEKLANQEPERKSGKEKKKKGFGKLRHGETNSFLPIFREPSSIEKILGEAERDHNLVFRPPTPDRPNPYSASPPPRPASPRVASPRPTSPRVASPRVPSPRAEVPRTLSPKPPSPRAEVPRSLSPKPPSPRADLPRSLSPKPFDRSKPSSASANAPPTLRPASTRVPSQRITPHSVPSPRPSSPRGASPQAISSKPPSPRAEPPTLDTPRPPSPRAASLRADPPRLDAARPTTPRPPSPLADAPRLDAPRPTTPKPPSPRSDPPRLDAPRPTTPKPPSPRSVSPRAVQRREIVYRPEPTLPVQHASATKIQGAFRGYMARKSFRALKGLVRLQGVVRGYSVKRQTINAMKYMQQVVRVQSQIQSRRIKMLENQAQVEKDEAKWAASEAGNDNWDDSVLTKEERDSRSQRKTDAIIKRERSMAYAYSRKLWKNSPKSTQDNRSFPQWWNWVDRQNPLASPAPSYSQPQRDFRLTPSRLCPSPLSQSSKQHHIRLDNHFDTSTPRSSRSTFHTPSRPIHTGTSRYSRGRLRGQDSPFKDDDSLTSCPPFPSYMAPTVSAKAKVRPNSNPKERVMGTPVSEKRRMSYPPTQDTFRWNKGSLVMSNSSSHRGPGSPGGVVLEKHKTLKSVGNLSIGSTASMATTVGRKEFNRFV

ID	PTM Type	Color
ph	Phosphorylation	X
ub	Ubiquitination	X
	Multiple types	X

Domains & Sites

Clear highlighted range

**Interpro Domains**
Show	IPR ID	Description	From	To
	IPR025064	Domain of unknown function DUF4005	549	644

AT2G43680.1

Arabidopsis thaliana [ath]

IQ-domain 14

73 PTM sites : 2 PTM types

PLAZA: AT2G43680

Gene Family: HOM05D000156

Other Names: IQD14

Uniprot

A0A178VRE6

B3H4F6

Link out to other resources with this protein ID : TAIR | PeptideAtlas | ARAPORT | PhosPhAt

PTMs

Sequence

Length: 669

Domains & Sites

BLAST

Perform a BLAST search for this sequence, or a part of this sequence (minimum 50 characters)
A downloadable tutorial can be found here

AT2G43680.1

Arabidopsis thaliana [ath]

IQ-domain 14

73 PTM sites : 2 PTM types

PLAZA: AT2G43680

Gene Family: HOM05D000156

Other Names: IQD14

Uniprot

A0A178VRE6

B3H4F6

Link out to other resources with this protein ID : TAIR | PeptideAtlas | ARAPORT | PhosPhAt

PTMs

Sequence

Length: 669

Domains & Sites

BLAST

Perform a BLAST search for this sequence, or a part of this sequence (minimum 50 characters)A downloadable tutorial can be found here

Perform a BLAST search for this sequence, or a part of this sequence (minimum 50 characters)
A downloadable tutorial can be found here